PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000181570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 435aa    MW: 48521.2 Da    PI: 8.2444
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000181570genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.71.3e-1388127848
                      HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      Ed+ +++ v+++G ++W+ Ia+ ++ gR +kqc++rw+++l
    MDP0000181570  88 EDDCIIKQVEKHGAKRWSVIAKFLP-GRIGKQCRERWHNHL 127
                      99***********************.*************97 PP

2Myb_DNA-binding51.13.1e-16133175145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r++WT++E+++++ +++++G++ W+ Iar ++ gRt++ +k++w+
    MDP0000181570 133 RDAWTKDEEQIIAYYHQLYGNK-WAEIARFLP-GRTDNAIKNFWN 175
                      789*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.70476127IPR017930Myb domain
SuperFamilySSF466893.92E-2780174IPR009057Homeodomain-like
SMARTSM007179.6E-880129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2188134IPR009057Homeodomain-like
PfamPF002491.4E-1288127IPR001005SANT/Myb domain
CDDcd001672.29E-1288127No hitNo description
PROSITE profilePS5129419.636128182IPR017930Myb domain
SMARTSM007177.5E-16132180IPR001005SANT/Myb domain
PfamPF002499.5E-14133175IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-20135181IPR009057Homeodomain-like
CDDcd001674.60E-12135178No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MTKINGEHPE DAGVGSHEKM GFLFQALYEX EYCSDSPFPK PSSIHWRTTV PTRRSAKSWT  60
AEELHVSPGV QIFSACNAGK RTMFCCREDD CIIKQVEKHG AKRWSVIAKF LPGRIGKQCR  120
ERWHNHLCPA INRDAWTKDE EQIIAYYHQL YGNKWAEIAR FLPGRTDNAI KNFWNCTLKR  180
KFDSYSPNGC EVDMQSDVSS GEVRTDRLEV EEDGQISDSV VSLNQLTETE IXDNACSTEL  240
TLGFSYSHDI CSEWKSVIVQ KRRSTERRAS SLINPLIATP FAFMDASTCT KSNCIPPTRP  300
PCYSTPRSLA QNTSVSSGSP GSRLKNLALS FKNTPSIIRK KSSRRXDPNN FPDVNSSKAC  360
STLSXTSEGG GTNSRDFANG KFGSFSFRHR PQNSAAVKSL GRRLEHEFDA EKDSGSDQCG  420
HAFSAYASPD VGFGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-398818111104C-Myb DNA-Binding Domain
1msf_C2e-398818111104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008369461.10.0PREDICTED: uncharacterized protein LOC103433015
TrEMBLM5WS751e-133M5WS75_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133012528
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.14e-46myb domain protein 3r-4